SRI Seed Idea

Boston High Protein Journal

Start with baby spinach. Add chickpeas, fennel, olives, celery, raisin, feta, cashews, and kamut. Finish with green goddess. Taste before serving and adjust acid, crunch, and salt.

8.8Rating
453Cal est.
7Minutes
Low CarbStyle

Ingredients

baby spinachchickpeasfennelolivesceleryraisinfetacashewskamutgreen goddess

Tasting Notes

Start with baby spinach. Add chickpeas, fennel, olives, celery, raisin, feta, cashews, and kamut. Finish with green goddess. Taste before serving and adjust acid, crunch, and salt.

Salad Lingerie™

Try a blend of 70% olive oil and 25% vinegar with a dash of soy sauce instead of salt and a spoonful of mayonnaise. Whisk with a fork for 60 seconds or use a food processor.

You don't dress up a great salad idea with store-bought dressing — our salads always wear custom-made lingerie.

Add Some CrewCrunch™

If you must wear something, a classic crew neck is always a safe bet. Likewise, crunchy toasted bread croutons are always a good add-on to any salad.

Try this simple recipe: take four large pieces of whatever bread you have, sourdough best, and cut into large cubes. Place on a toaster oven rack or oven rack. Drizzle with olive oil, salt and pepper to taste. Add sage and rosemary fresh herbs. Cook on low heat at 200–250°F for 20–30 minutes.

Boston High Protein Journal